PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19925.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 767aa    MW: 84133.8 Da    PI: 7.6669
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19925.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-094444811954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  KHN19925.1 444 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 481
                 554459******************************88 PP

2BELL120.28.9e-39308379172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +rqelq+kk+kL+++l+eV++rY+qy++q+q+vi sFe++ag+g+ak+Yt+lAlk+iS++FrcLkdai++qi
  KHN19925.1 308 QRQELQMKKSKLVTMLDEVEQRYRQYHHQMQIVITSFEQAAGVGAAKSYTALALKTISKQFRCLKDAISSQI 379
                 69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-59226377IPR006563POX domain
PfamPF075269.4E-49234376IPR006563POX domain
PROSITE profilePS5007112.082422485IPR001356Homeobox domain
CDDcd000863.39E-12425486No hitNo description
SMARTSM003897.8E-10425489IPR001356Homeobox domain
SuperFamilySSF466897.7E-17426491IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28428491IPR009057Homeodomain-like
PfamPF059205.3E-18442481IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MATYFHGSTS ETPSSAEGLQ TLYLMNPNYV VPYSDAAQHP TQNMLLVNPN NNTSNTSSTS  60
TNALNLGNFS HAPPPPSPNN NREHHHHHLT GVTIPSSNFL LSNAAADPAR SSFLGQHEFS  120
GFHSSAAATT STAAASRGNN YNLWGSIFDQ SASNIMTSTT HTPSSNMGCV IGHSTQIGFH  180
RPNHLSLSLS SQQTPYSSLS GETHAISLAN RGGGGDDMRG MHNGVSSMHS VSLGSKYLKA  240
TQELLDEVVN VGKGIFKGEE SMEGDKKEKM KGNIESTSWV GDGSSCGGGE NNNNNDGGKQ  300
GVELSTAQRQ ELQMKKSKLV TMLDEVEQRY RQYHHQMQIV ITSFEQAAGV GAAKSYTALA  360
LKTISKQFRC LKDAISSQIK TTSKTLGEDD CLGVKVEGSR LRYVDHQLRQ QRALQQLGMI  420
QHNAWRPQRG LPERAVSVLR AWLFEHFLHP YPKDSDKVML AKQTGLTRSQ VSNWFINARV  480
RLWKPMVEEM YLEEVKQEPN NSSQDNTTKR SKESSKELWS EANATAQESG AMRLDHINIL  540
QSKAESFNNN NNNQTTSPTE ISNNSHNSLQ SAGFHLADMQ SPNKPIRSTS EMQNSPGSIL  600
SVDMEMKPRH HGETNNNTII TREGNNNTTK FGIESHGGGG GGFGAFPNME DIGRFHHHHH  660
HHHHVTDQQS LAPRFHGNGV SLTLGLPHST ENNNNLSLSG TTHQHGFLSQ NMHLGMRSTT  720
NNANNEFCGA INTTPPSNSH SGTSYESIDI IQNRKRFAAQ LLRDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-16431488158Homeobox protein Meis1
4xrs_A2e-16431488158Homeobox protein Meis1
3k2a_B2e-16431489563Homeobox protein Meis2
3k2a_A2e-16431489563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-142AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539151.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_006591059.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_006591060.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_014628598.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0B2QF660.0A0A0B2QF66_GLYSO; BEL1-like homeodomain protein 1
STRINGGLYMA11G18270.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-111BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]